PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462940994
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family Nin-like
Protein Properties Length: 859aa    MW: 95734.5 Da    PI: 7.0391
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462940994genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.81.1e-28496547152
     RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                aek+isl++l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  462940994 496 AEKTISLDVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 547
                589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.541486567IPR003035RWP-RK domain
PfamPF020425.9E-26499547IPR003035RWP-RK domain
SuperFamilySSF542771.34E-18744820No hitNo description
PfamPF005642.2E-12749816IPR000270PB1 domain
SMARTSM006664.6E-18749836IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.3E-21749816No hitNo description
PROSITE profilePS5174518.416749825IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 859 aa     Download sequence    Send to blast
MGNSDTTSKR VEQINHKWQL HLSLDGDGTD NSSLFKERLT QALRYFKDST DQHLLVQVWA  60
PVKNGDRYVL TTSGQPFVLD HQSIGLLQYR AVSMMYMFSV DGDNAGELGL PGRVYKQKVP  120
EWTPNVQYYS SNEYPRLNHA ISYNVHGTVA LPVFDPSAQS CIAVVELIMT SKKINYACEV  180
DKVCKALEAV NLKSTEIFDH PNVQICNEGR QTALVEILEI LTVVCEEHKL PLAQTWVPCK  240
YRSVLAHGGG LKKSCLSFDG SCMGEVCMST SDVAFHVIDA HMWGFRDACV EHHLQRGQGV  300
PGKAFISRKP CFSKDIRQFC KLEYPLVHYA RMFGLAGCFA ICLQSSYTGH DDYILEFFLP  360
PDCIDENDQN ALLESILTRM KRCLRSLKVV GDRDLNGVSL QLGNVLKIEN DEFKKDVQYD  420
NSEGCLRESP EGDTRGRVHD FDTETKRVSN MPEGHILADD QSLDNGTSAT RPNGSSASDS  480
LLHKTNKPPE RRRGKAEKTI SLDVLQQYFS GSLKNAAKSL GVCPTTMKRI CRQHGISRWP  540
SRKINKVNRS LSKLKQVIES VQGSDAAFNL TSITGPLPIP VGPSSDSLNL EKVTQSKVAE  600
LSNPTIDGDR DSCLQKSLEN DGHFGILMPQ QGFMDNNNDA QLEADKASHS RSSSGEGSIN  660
SRTSEGSCQG SPANQTFVCK PIASTFAEPQ INPEEFTKEP FQEPQLPLSR MLIEDSGSSK  720
DLKNLFTSAA DQPIFATPSN LRSMKHSGTV TIKASFKEDI VRFRFPCSGS VTVLKDEVAK  780
RLRMDVGMFD IKYLDDDHEW VKLACNADLE ECMEISYSQL LPHSRSPRLI QRSSQKSLFK  840
NHSYHYPGCS LRILAAPKI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0853590.0BT085359.2 Zea mays full-length cDNA clone ZM_BFc0002J20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967359.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLK3XE990.0K3XE99_SETIT; Uncharacterized protein
STRINGSi000216m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein